Boeken over voeding - Vanaf 50%

45 resultaten

Deze pagina is ingesteld op tegelweergave. Om de weergave van deze pagina te wijzigen van tegelweergave naar lijstweergave, klik deze button.

  • Solutions to Lift the Fog and Light the Way
    • Engels
    • E-book
    • 9781529376579
    • 04 mei 2023
    • Adobe ePub

    'A brilliantly comprehensive book, packed with genuinely helpful information to assist all those needing…

    Prijsinformatie en bestellen

    De prijs van dit product is 3 euro en 99 cent.
    Meestal 12,99

    Je bespaart 69%

    Direct beschikbaar
    Verkoop door bol
  • 365-Day Easy, Gluten-Free, Oil-Free Recipes for Nutritionally Balanced, One- Bowl Vegan Meals
    • Engels
    • Paperback
    • 9781639351350
    • 31 mei 2021
    • 94 pagina's

    Prijsinformatie en bestellen

    De prijs van dit product is 4 euro en 49 cent.
    Meestal 9,01

    Je bespaart 50%

    Op voorraad
    Select Voor 23:59 uur besteld, dinsdag in huis
    Verkoop door bol
  • A Radical New Way to Heal Your Body from the Inside Out
    • Engels
    • E-book
    • 9780698193918
    • 25 augustus 2015
    • Adobe ePub

    The author of Gutbliss and one of today’s preeminent gastroenterologists distills the latest research…

    Prijsinformatie en bestellen

    De prijs van dit product is 5 euro en 99 cent.
    Meestal 11,99

    Je bespaart 50%

    Direct beschikbaar
    Verkoop door bol
  • Het 5:2 dieet Tweedehands
    5 dagen genieten en 2 dagen calorieen tellen
    • Nederlands
    • Paperback
    • 9789021554969
    • 26 november 2013
    • 272 pagina's

    Het Vastendieet is de hype van dit moment! Iedereen is ervan overtuigd dat 2 dagen minder eten het recept…

    Prijsinformatie en bestellen

    De prijs van dit product is 8 euro en 45 cent. Dit is een tweedehands product.
    Tweedehands vanaf 8,44

    Ebook 6,99

  • het motivatieboek voor mensen die willen afvallen
    • Nederlands
    • Paperback
    • 9789089545947
    • 23 december 2013
    • 165 pagina's

    Meer dan veertig procent van de bevolking heeft overgewicht en veel mensen doen ook iets om hun gewicht…

    Prijsinformatie en bestellen

    De prijs van dit product is 8 euro en 45 cent. De adviesprijs is 18 euro en 50 cent. Je bespaart 54%. Dit is een tweedehands product.
    • Engels
    • E-book
    • 9781465742414
    • 31 januari 2010
    • Epub zonder kopieerbeveiliging (DRM)

    During this time, she tried to overcome denial and self-hate, along with trying many fat loss diets;…

    Prijsinformatie en bestellen

    De prijs van dit product is 0 euro en 85 cent.
    Meestal 1,99

    Je bespaart 57%

    Direct beschikbaar
    Verkoop door bol
    Ook beschikbaar in Kobo Plus.
  • The Best Eating Plan to Control Your Weight and Improve Your Health for Life
    • Engels
    • E-book
    • 9781538715246
    • 24 december 2018

    From the New York Times bestselling author, this guide to healthy living features the latest science…

    Prijsinformatie en bestellen

    De prijs van dit product is 4 euro en 49 cent.
    Meestal 8,99

    Je bespaart 50%

    Direct beschikbaar
    Verkoop door bol
    • Engels
    • E-book
    • 9781311497208
    • 04 juli 2015
    • Epub zonder kopieerbeveiliging (DRM)

    What is a doctor of philosophy, whose thesis on education-as-alchemy focuses on the metaphysics of Quality,…

    Prijsinformatie en bestellen

    De prijs van dit product is 0 euro en 85 cent.
    Meestal 1,99

    Je bespaart 57%

    Direct beschikbaar
    Verkoop door bol
    Ook beschikbaar in Kobo Plus.
  • 550+ Quick, Savory and Creative Recipes to Impress Your Friends and Family
    • Engels
    • Hardcover
    • 9781802448894
    • 10 maart 2021
    • 256 pagina's

    Prijsinformatie en bestellen

    De prijs van dit product is 25 euro en 99 cent.
    Meestal 94,00

    Je bespaart 72%

    Uiterlijk 5 juni in huis
    Verkoop door bol
    • Engels
    • Paperback
    • 9780192627414
    • 31 juli 1997
    • 256 pagina's

    The Biochemistry of Exercise and Training provides the first broadly based introduction to those aspects…

    Prijsinformatie en bestellen

    De prijs van dit product is 26 euro en 06 cent. Dit is een tweedehands product.
  • Vomiting. Anoressia. Bulimia. La terapia in tempi brevi
    • Italiaans
    • E-book
    • 9788862206891
    • 01 april 2014
    • Adobe ePub

    Gli psichiatri di formazione biologista sostengono che esiste sicuramente un gene specifico responsabile…

    Prijsinformatie en bestellen

    De prijs van dit product is 2 euro en 99 cent.
    Meestal 6,99

    Je bespaart 57%

    Direct beschikbaar
    Verkoop door bol
    • Engels
    • Hardcover
    • 9781556426971
    • 30 mei 2006
    • 674 pagina's

    Covers various vital aspects of nutrition and serves as a resource on this topic. This is a practical…

    Prijsinformatie en bestellen

    De prijs van dit product is 169 euro. Dit is een tweedehands product.
  • Why Are Our Children Obese - and What Can We Do About It?
    • Engels
    • Hardcover
    • 9781771881029
    • 19 maart 2015
    • 318 pagina's

    This title includes a number of Open Access chapters. Child obesity is a serious condition that affects…

    Prijsinformatie en bestellen

    De prijs van dit product is 116 euro en 50 cent.
    Meestal 280,00

    Je bespaart 58%

    2 - 4 weken
    Verkoop door bol
    • Engels
    • Hardcover
    • 9780521420648
    • 15 oktober 1992
    • 424 pagina's

    This book details the contribution which nutrition research has made and continues to make to the health…

    Prijsinformatie en bestellen

    De prijs van dit product is 28 euro en 65 cent. Dit is een tweedehands product.
  • Probleme und Lösungsansätze
    • Engels
    • Hardcover
    • 9783540611356
    • 29 november 1996
    • 344 pagina's

    Die Autoren legen mit dem Buch eine bisher einmalige Darstellung der engen Beziehungen zwischen Lebensmittelbiotechnologie…

    Prijsinformatie en bestellen

    De prijs van dit product is 42 euro en 45 cent. Dit is een tweedehands product.
  • Über neueste biophysikalisch-wissenschaftliche Erkenntnisse zur Lebensenergie, zur Nahrungsenergie und zur Wirkungsweise der lebendigen vegetabilen Frischkost. Umfassende Anleitung zur Anwendung und Zubereitung der vegetabilen Rohkostdiät nach Bircher-Be
    • Duits
    • Hardcover
    • 9782970072232
    • 78 pagina's

    (Hand)buch für Frischsäfte, Rohkost und Früchtespeisen is een boek van Andres Bircher…

    Prijsinformatie en bestellen

    De prijs van dit product is 10 euro en 49 cent.
    Meestal 21,40

    Je bespaart 51%

    Op voorraad
    Select Voor 23:59 uur besteld, dinsdag in huis
    Verkoop door bol
    • Engels
    • Paperback
    • 9780412576508
    • 01 januari 1997
    • 565 pagina's

    Survival without any food at The reliable provision of food requires an orga all, but with water, may…

    Prijsinformatie en bestellen

    De prijs van dit product is 35 euro en 62 cent. Dit is een tweedehands product.
  • Evaluation of Clinical Trial Evidence
    • Engels
    • Hardcover
    • 9780824782160
    • 05 november 1999
    • 348 pagina's

    Reveals the results from clinical trials conducted in Scandinavia, Scotland, Australia, Canada, and the…

    Prijsinformatie en bestellen

    De prijs van dit product is 24 euro. Dit is een tweedehands product.
  • A Resource for Health Professionals
    • Engels
    • Hardcover
    • 9780387478593
    • 18 september 2007
    • 538 pagina's

    Analyzes the intricate causes of obesity prevention, and sets out multilevel strategies for meeting it.…

    Prijsinformatie en bestellen

    De prijs van dit product is 35 euro en 94 cent. Dit is een tweedehands product.
  • A Reference Handbook
    • Engels
    • Hardcover
    • 9780192623683
    • 03 oktober 1996
    • 612 pagina's

    This book provides in a single volume all of the nutritional information that is likely to be needed…

    Prijsinformatie en bestellen

    De prijs van dit product is 35 euro en 30 cent. Dit is een tweedehands product.
  • Nutrition and Alcohol Tweedehands
    Linking Nutrient Interactions and Dietary Intake
    • Engels
    • Hardcover
    • 9780849316807
    • 17 december 2003
    • 448 pagina's

    Explores the data on the effects of alcohol on the nutritional state of alcohol abusers. This book illustrates…

    Prijsinformatie en bestellen

    De prijs van dit product is 45 euro en 64 cent. Dit is een tweedehands product.
    • Engels
    • Hardcover
    • 9780849379130
    • 25 oktober 1994
    • 336 pagina's

    This book describes the application of a wide range of nutrients and dietary substances to the enhancement…

    Prijsinformatie en bestellen

    De prijs van dit product is 60 euro en 74 cent. Dit is een tweedehands product.

    Ebook 77,00

  • Biochemical and Health Implications
    • Engels
    • Hardcover
    • 9780849385681
    • 21 november 2001
    • 280 pagina's

    The amino acid tryptophan has been considered to play a role in cancer development and the aging process.…

    Prijsinformatie en bestellen

    De prijs van dit product is 151 euro en 96 cent. Dit is een tweedehands product.
  • Prevalence, Policy, and Politics
    • Engels
    • Hardcover
    • 9781771884914
    • 20 december 2016
    • 280 pagina's

    Providing a nuanced look at food insecurity and its connection to disease, the book advances our understanding…

    Prijsinformatie en bestellen

    De prijs van dit product is 124 euro en 99 cent.
    Meestal 251,99

    Je bespaart 50%

    2 - 4 weken
    Verkoop door bol
  • 1
  • 2